HABP2 antibody (Middle Region)

Catalog No. ABIN634644

Product Details anti-HABP2 Antibody

Target: HABP2 (Hyaluronan Binding Protein 2 (HABP2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HABP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HABP2 antibody was raised against the middle region of HABP2

Purification: Affinity purified

Immunogen: HABP2 antibody was raised using the middle region of HABP2 corresponding to a region with amino acids EPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HABP2 Blocking Peptide, catalog no. 33R-2649, is also available for use as a blocking control in assays to test for specificity of this HABP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HABP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HABP2

Target: HABP2 (Hyaluronan Binding Protein 2 (HABP2))

Alternative Name: HABP2 (HABP2 Products)

Synonyms: HABP2 antibody, habp2 antibody, FSAP antibody, HABP antibody, HGFAL antibody, PHBP antibody, Fsap antibody, Habp antibody, Phbp antibody, AI035669 antibody, hyaluronan binding protein 2 antibody, hyaluronic acid binding protein 2 antibody, HABP2 antibody, habp2 antibody, Habp2 antibody

Background: HABP2 is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. It is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen.

Molecular Weight: 63 kDa (MW of target protein)