GJB6 antibody (Middle Region)

Catalog No. ABIN634670

Product Details anti-GJB6 Antibody

Target: GJB6 (Gap Junction Protein, beta 6, 30kDa (GJB6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJB6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJB6 antibody was raised against the middle region of GJB6

Purification: Affinity purified

Immunogen: GJB6 antibody was raised using the middle region of GJB6 corresponding to a region with amino acids CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJB6 Blocking Peptide, catalog no. 33R-1835, is also available for use as a blocking control in assays to test for specificity of this GJB6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJB6

Target: GJB6 (Gap Junction Protein, beta 6, 30kDa (GJB6))

Alternative Name: GJB6 (GJB6 Products)

Synonyms: connexin-26 antibody, cx26 antibody, cx30 antibody, dfna3 antibody, dfna3a antibody, dfnb1 antibody, dfnb1a antibody, ed2 antibody, edh antibody, gjb6 antibody, hed antibody, nsrd1 antibody, ppk antibody, AA958971 antibody, Cx30 antibody, D14Bwg0506e antibody, CX30 antibody, DFNA3 antibody, DFNA3B antibody, DFNB1B antibody, ECTD2 antibody, ED2 antibody, EDH antibody, HED antibody, HED2 antibody, CX31 antibody, connexin 30 antibody, gap junction protein beta 2 antibody, gap junction protein beta 6 antibody, gap junction protein, beta 6 antibody, LOC387566 antibody, gjb2 antibody, GJB6 antibody, Gjb6 antibody

Background: Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Sensory Perception of Sound