GJA9 antibody (Middle Region)

Catalog No. ABIN634673

Product Details anti-GJA9 Antibody

Target: GJA9 (Gap Junction Protein, alpha 9, 59kDa (GJA9))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJA9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJA9 antibody was raised against the middle region of GJA9

Purification: Affinity purified

Immunogen: GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJA9 Blocking Peptide, catalog no. 33R-3913, is also available for use as a blocking control in assays to test for specificity of this GJA9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJA9

Target: GJA9 (Gap Junction Protein, alpha 9, 59kDa (GJA9))

Alternative Name: GJA9 (GJA9 Products)

Synonyms: CX58 antibody, CX59 antibody, GJA10 antibody, gap junction protein alpha 9 antibody, GJA9 antibody

Background: Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits.

Molecular Weight: 59 kDa (MW of target protein)