PCDH12 antibody (Middle Region)

Catalog No. ABIN634683

Product Details anti-PCDH12 Antibody

Target: PCDH12 (Protocadherin 12 (PCDH12))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDH12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDH12 antibody was raised against the middle region of PCDH12

Purification: Affinity purified

Immunogen: PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDH12 Blocking Peptide, catalog no. 33R-8846, is also available for use as a blocking control in assays to test for specificity of this PCDH12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDH12

Target: PCDH12 (Protocadherin 12 (PCDH12))

Alternative Name: PCDH12 (PCDH12 Products)

Synonyms: PCDH12 antibody, VE-cadherin-2 antibody, VECAD2 antibody, Pcdh14 antibody, VE-cad-2 antibody, protocadherin 12 antibody, PCDH12 antibody, Pcdh12 antibody

Background: PCDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.

Molecular Weight: 126 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process