SSPN antibody

Catalog No. ABIN634685

Product Details anti-SSPN Antibody

Target: SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SSPN antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Sarcospan antibody was raised using a synthetic peptide corresponding to a region with amino acids AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Sarcospan Blocking Peptide, catalog no. 33R-1245, is also available for use as a blocking control in assays to test for specificity of this Sarcospan antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SSPN

Target: SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))

Alternative Name: Sarcospan (SSPN Products)

Synonyms: DAGA5 antibody, KRAG antibody, NSPN antibody, SPN1 antibody, SPN2 antibody, Krag antibody, RGD1559723 antibody, sarcospan S homeolog antibody, sarcospan antibody, sspn.S antibody, SSPN antibody, Sspn antibody

Background: SSPN is a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells.SSPN gene is expressed in a variety of tissues with highest levels in muscle, where alternative splice variants have been observed. In certain tumors KRAS2, SSPN, and ITPR2 are coamplified. The function of this gene is unknown.

Molecular Weight: 26 kDa (MW of target protein)