DGCR2 antibody (Middle Region)

Catalog No. ABIN634699

Product Details anti-DGCR2 Antibody

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DGCR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DGCR2 antibody was raised against the middle region of DGCR2

Purification: Affinity purified

Immunogen: DGCR2 antibody was raised using the middle region of DGCR2 corresponding to a region with amino acids AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DGCR2 Blocking Peptide, catalog no. 33R-1148, is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DGCR2

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Alternative Name: DGCR2 (DGS2 Products)

Synonyms: DGS-C antibody, IDD antibody, LAN antibody, SEZ-12 antibody, CIDD antibody, 9930034O06Rik antibody, Dgsc antibody, Idd antibody, Lan antibody, Sez12 antibody, mKIAA0163 antibody, zgc:91974 antibody, DiGeorge syndrome critical region gene 2 antibody, DiGeorge syndrome critical region gene 2 S homeolog antibody, DGCR2 antibody, Dgcr2 antibody, dgcr2 antibody, dgcr2.S antibody

Background: Deletions of the 22q11.2 have been associated with a wide range of developmental defects classified under the acronym CATCH 22. The DGCR2 is a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome.

Molecular Weight: 61 kDa (MW of target protein)