PCDHGC4 antibody (N-Term)

Catalog No. ABIN634714

Product Details anti-PCDHGC4 Antibody

Target: PCDHGC4 (Protocadherin gamma Subfamily C, 4 (PCDHGC4))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHGC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDHGC4 antibody was raised against the N terminal of PCDHGC4

Purification: Affinity purified

Immunogen: PCDHGC4 antibody was raised using the N terminal of PCDHGC4 corresponding to a region with amino acids VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHGC4 Blocking Peptide, catalog no. 33R-9627, is also available for use as a blocking control in assays to test for specificity of this PCDHGC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHGC4

Target: PCDHGC4 (Protocadherin gamma Subfamily C, 4 (PCDHGC4))

Alternative Name: PCDHGC4 (PCDHGC4 Products)

Synonyms: PCDH-GAMMA-C4 antibody, protocadherin gamma c4 antibody, protocadherin gamma subfamily C, 4 antibody, Pcdhgc4 antibody, PCDHGC4 antibody

Background: PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molecular Weight: 98 kDa (MW of target protein)