PCDHGB1 antibody (N-Term)

Catalog No. ABIN634720

Product Details anti-PCDHGB1 Antibody

Target: PCDHGB1 (Protocadherin gamma Subfamily B, 1 (PCDHGB1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHGB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDHGB1 antibody was raised against the N terminal of PCDHGB1

Purification: Affinity purified

Immunogen: PCDHGB1 antibody was raised using the N terminal of PCDHGB1 corresponding to a region with amino acids SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHGB1 Blocking Peptide, catalog no. 33R-8667, is also available for use as a blocking control in assays to test for specificity of this PCDHGB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHGB1

Target: PCDHGB1 (Protocadherin gamma Subfamily B, 1 (PCDHGB1))

Alternative Name: PCDHGB1 (PCDHGB1 Products)

Synonyms: PCDH-GAMMA-B1 antibody, protocadherin gamma subfamily B, 1 antibody, PCDHGB1 antibody, Pcdhgb1 antibody

Background: PCDHGB1 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGB1 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molecular Weight: 85 kDa (MW of target protein)