OSGIN1 antibody (N-Term)

Catalog No. ABIN634776

Product Details anti-OSGIN1 Antibody

Target: OSGIN1 (Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OSGIN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OSGIN1 antibody was raised against the N terminal of OSGIN1

Purification: Affinity purified

Immunogen: OSGIN1 antibody was raised using the N terminal of OSGIN1 corresponding to a region with amino acids APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OSGIN1 Blocking Peptide, catalog no. 33R-1422, is also available for use as a blocking control in assays to test for specificity of this OSGIN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OSGIN1

Target: OSGIN1 (Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1))

Alternative Name: OSGIN1 (OSGIN1 Products)

Synonyms: 1700012B18Rik antibody, Okl38 antibody, 1700012B18RIK antibody, BDGI antibody, OKL38 antibody, oxidative stress induced growth inhibitor 1 antibody, OSGIN1 antibody, Osgin1 antibody

Background: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Molecular Weight: 61 kDa (MW of target protein)