Norrie Disease (Pseudoglioma) antibody

Catalog No. ABIN634783

Product Details anti-Norrie Disease (Pseudoglioma) Antibody

Target: Norrie Disease (Pseudoglioma) (NDP)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Norrie Disease (Pseudoglioma) antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NDP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDP Blocking Peptide, catalog no. 33R-2114, is also available for use as a blocking control in assays to test for specificity of this NDP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Norrie Disease (Pseudoglioma)

Target: Norrie Disease (Pseudoglioma) (NDP)

Alternative Name: NDP (NDP Products)

Synonyms: EVR2 antibody, FEVR antibody, ND antibody, evr2 antibody, fevr antibody, xnorrin antibody, Ndph antibody, RGD1563968 antibody, NDP, norrin cystine knot growth factor antibody, Norrie disease (pseudoglioma) L homeolog antibody, Norrie disease (pseudoglioma) (human) antibody, NDP antibody, ndp.L antibody, Ndp antibody

Background: NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1).

Molecular Weight: 15 kDa (MW of target protein)

Pathways: Sensory Perception of Sound