CSHL1 antibody (C-Term)

Catalog No. ABIN634789

Product Details anti-CSHL1 Antibody

Target: CSHL1 (Chorionic Somatomammotropin Hormone-Like 1 (CSHL1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSHL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CSHL1 antibody was raised against the C terminal of CSHL1

Purification: Affinity purified

Immunogen: CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSHL1 Blocking Peptide, catalog no. 33R-3515, is also available for use as a blocking control in assays to test for specificity of this CSHL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSHL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSHL1

Target: CSHL1 (Chorionic Somatomammotropin Hormone-Like 1 (CSHL1))

Alternative Name: CSHL1 (CSHL1 Products)

Synonyms: CSHL1 antibody, PL-D antibody, CS-5 antibody, CSHP1 antibody, CSL antibody, hCS-L antibody, placental lactogen PL-D antibody, chorionic somatomammotropin hormone like 1 antibody, PL-D antibody, CSHL1 antibody

Background: CSHL1 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein.

Molecular Weight: 20 kDa (MW of target protein)