Motilin antibody (Middle Region)

Catalog No. ABIN634816

Product Details anti-Motilin Antibody

Target: Motilin (MLN)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Motilin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Motilin antibody was raised against the middle region of MLN

Purification: Affinity purified

Immunogen: Motilin antibody was raised using the middle region of MLN corresponding to a region with amino acids LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Motilin Blocking Peptide, catalog no. 33R-5335, is also available for use as a blocking control in assays to test for specificity of this Motilin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Motilin

Target: Motilin (MLN)

Alternative Name: Motilin (MLN Products)

Synonyms: MLN antibody, motilin antibody, MLN antibody, Mln antibody

Background: This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility.

Molecular Weight: 3 kDa (MW of target protein)

Pathways: Hormone Activity