Motilin antibody (Middle Region)
-
- Target See all Motilin (MLN) Antibodies
- Motilin (MLN)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Motilin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Motilin antibody was raised against the middle region of MLN
- Purification
- Affinity purified
- Immunogen
- Motilin antibody was raised using the middle region of MLN corresponding to a region with amino acids LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE
- Top Product
- Discover our top product MLN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Motilin Blocking Peptide, catalog no. 33R-5335, is also available for use as a blocking control in assays to test for specificity of this Motilin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Motilin (MLN)
- Alternative Name
- Motilin (MLN Products)
- Synonyms
- MLN antibody, motilin antibody, MLN antibody, Mln antibody
- Background
- This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility.
- Molecular Weight
- 3 kDa (MW of target protein)
- Pathways
- Hormone Activity
-