LCLAT1 antibody (Middle Region)
-
- Target See all LCLAT1 Antibodies
- LCLAT1 (Lysocardiolipin Acyltransferase 1 (LCLAT1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LCLAT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LYCAT antibody was raised against the middle region of LYCAT
- Purification
- Affinity purified
- Immunogen
- LYCAT antibody was raised using the middle region of LYCAT corresponding to a region with amino acids YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
- Top Product
- Discover our top product LCLAT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LYCAT Blocking Peptide, catalog no. 33R-10186, is also available for use as a blocking control in assays to test for specificity of this LYCAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYCAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LCLAT1 (Lysocardiolipin Acyltransferase 1 (LCLAT1))
- Alternative Name
- LYCAT (LCLAT1 Products)
- Synonyms
- lclat1 antibody, zgc:77380 antibody, wu:fj17g04 antibody, LYCAT antibody, lycat antibody, agpat8 antibody, alcat1 antibody, 1agpat8 antibody, AGPATP8 antibody, 1AGPAT8 antibody, AGPAT8 antibody, ALCAT1 antibody, HSRG1849 antibody, UNQ1849 antibody, AI181996 antibody, Agpat8 antibody, Alcat1 antibody, Gm91 antibody, Lycat antibody, RGD1565906 antibody, lysocardiolipin acyltransferase 1 antibody, lclat1 antibody, LCLAT1 antibody, Lclat1 antibody
- Background
- LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognises both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.
- Molecular Weight
- 44 kDa (MW of target protein)
-