SLC37A4 antibody

Catalog No. ABIN634867

Product Details anti-SLC37A4 Antibody

Target: SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC37A4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC37 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC37A4 Blocking Peptide, catalog no. 33R-9804, is also available for use as a blocking control in assays to test for specificity of this SLC37A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC37A4

Target: SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))

Alternative Name: SLC37A4 (SLC37A4 Products)

Synonyms: G6PT1 antibody, G6PT2 antibody, G6PT3 antibody, GSD1b antibody, GSD1c antibody, GSD1d antibody, TRG-19 antibody, TRG19 antibody, G6PC antibody, G6PT antibody, G6pt1 antibody, GSD-1b antibody, mG6PT antibody, MGC68695 antibody, g6pt1 antibody, g6pt2 antibody, g6pt3 antibody, gsd1b antibody, gsd1c antibody, gsd1d antibody, trg19 antibody, pro0685 antibody, MGC97640 antibody, slc37a4 antibody, wu:fc25d06 antibody, zgc:77098 antibody, solute carrier family 37 member 4 antibody, solute carrier family 37 (glucose-6-phosphate transporter), member 4 antibody, solute carrier family 37 member 4 L homeolog antibody, solute carrier family 37 (glucose-6-phosphate transporter), member 4a antibody, SLC37A4 antibody, Slc37a4 antibody, slc37a4.L antibody, slc37a4 antibody, slc37a4a antibody

Background: SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cellular Glucan Metabolic Process