KLHL31 antibody

Catalog No. ABIN634869

Product Details anti-KLHL31 Antibody

Target: KLHL31 (Kelch-Like 31 (KLHL31))

Reactivity: Mouse, Human, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL31 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL31 Blocking Peptide, catalog no. 33R-9231, is also available for use as a blocking control in assays to test for specificity of this KLHL31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL31

Target: KLHL31 (Kelch-Like 31 (KLHL31))

Alternative Name: KLHL31 (KLHL31 Products)

Synonyms: 9830147P19Rik antibody, D930047P17Rik antibody, Kbtbd1 antibody, fb95e08 antibody, kbtbd1 antibody, klhl antibody, wu:fa31h10 antibody, wu:fb95e08 antibody, BKLHD6 antibody, KBTBD1 antibody, KLHL antibody, bA345L23.2 antibody, RGD1560540 antibody, kelch-like 31 antibody, kelch-like family member 31 antibody, kelch like family member 31 antibody, Klhl31 antibody, klhl31 antibody, KLHL31 antibody

Background: KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)

Molecular Weight: 70 kDa (MW of target protein)