LEMD2 antibody (Middle Region)
-
- Target See all LEMD2 Antibodies
- LEMD2 (LEM Domain Containing 2 (LEMD2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LEMD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LEMD2 antibody was raised against the middle region of LEMD2
- Purification
- Affinity purified
- Immunogen
- LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE
- Top Product
- Discover our top product LEMD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LEMD2 Blocking Peptide, catalog no. 33R-8774, is also available for use as a blocking control in assays to test for specificity of this LEMD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEMD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LEMD2 (LEM Domain Containing 2 (LEMD2))
- Alternative Name
- LEMD2 (LEMD2 Products)
- Synonyms
- NET25 antibody, dJ482C21.1 antibody, BC026588 antibody, Lem2 antibody, LEM domain containing 2 antibody, LEMD2 antibody, Lemd2 antibody
- Background
- LEMD2 is involved in nuclear structure organization.
- Molecular Weight
- 57 kDa (MW of target protein)
-