CLN6 antibody (C-Term)

Catalog No. ABIN634889

Product Details anti-CLN6 Antibody

Target: CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLN6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CLN6 antibody was raised against the C terminal of CLN6

Purification: Affinity purified

Immunogen: CLN6 antibody was raised using the C terminal of CLN6 corresponding to a region with amino acids RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLN6 Blocking Peptide, catalog no. 33R-8022, is also available for use as a blocking control in assays to test for specificity of this CLN6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLN6

Target: CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))

Alternative Name: CLN6 (CLN6 Products)

Synonyms: 1810065L06Rik antibody, AW743417 antibody, D9Bwg1455e antibody, nclf antibody, CLN4A antibody, HsT18960 antibody, cln6 antibody, zgc:103565 antibody, ceroid-lipofuscinosis, neuronal 6 antibody, CLN6, transmembrane ER protein antibody, CLN6, transmembrane ER protein S homeolog antibody, ceroid-lipofuscinosis, neuronal 6, late infantile, variant antibody, CLN6, transmembrane ER protein a antibody, Cln6 antibody, CLN6 antibody, cln6.S antibody, cln6a antibody

Background: CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process