ZDHHC16 antibody (N-Term)

Catalog No. ABIN634917

Product Details anti-ZDHHC16 Antibody

Target: ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZDHHC16 antibody was raised against the N terminal of ZDHHC16

Purification: Affinity purified

Immunogen: ZDHHC16 antibody was raised using the N terminal of ZDHHC16 corresponding to a region with amino acids SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC16 Blocking Peptide, catalog no. 33R-8922, is also available for use as a blocking control in assays to test for specificity of this ZDHHC16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC16

Target: ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))

Alternative Name: ZDHHC16 (ZDHHC16 Products)

Synonyms: APH2 antibody, MGC132171 antibody, 1500015N03Rik antibody, Aph2 antibody, zdhhc16 antibody, zgc:66369 antibody, zgc:63934 antibody, zinc finger DHHC-type containing 16 antibody, zinc finger, DHHC-type containing 16 S homeolog antibody, zinc finger, DHHC-type containing 16 antibody, zinc finger, DHHC domain containing 16 antibody, zinc finger, DHHC-type containing 16a antibody, zinc finger, DHHC-type containing 16b antibody, ZDHHC16 antibody, zdhhc16.S antibody, Zdhhc16 antibody, zdhhc16 antibody, zdhhc16a antibody, zdhhc16b antibody

Background: ZDHHC16 may be involved in apoptosis regulation.

Molecular Weight: 44 kDa (MW of target protein)