ATP2B4 antibody (Middle Region)
-
- Target See all ATP2B4 Antibodies
- ATP2B4 (ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP2B4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP2 B4 antibody was raised against the middle region of ATP2 4
- Purification
- Affinity purified
- Immunogen
- ATP2 B4 antibody was raised using the middle region of ATP2 4 corresponding to a region with amino acids FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK
- Top Product
- Discover our top product ATP2B4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP2B4 Blocking Peptide, catalog no. 33R-2841, is also available for use as a blocking control in assays to test for specificity of this ATP2B4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP2B4 (ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4))
- Alternative Name
- ATP2B4 (ATP2B4 Products)
- Synonyms
- ATP2B2 antibody, MXRA1 antibody, PMCA4 antibody, PMCA4b antibody, PMCA4x antibody, atp2b2 antibody, atp2b3 antibody, mxra1 antibody, pmca4 antibody, pmca4b antibody, pmca4x antibody, zgc:152801 antibody, ATP2B4 antibody, ATP2B1 antibody, Pmca4 antibody, ATPase plasma membrane Ca2+ transporting 4 antibody, ATPase, Ca++ transporting, plasma membrane 4 L homeolog antibody, ATPase, Ca++ transporting, plasma membrane 4 antibody, ATP2B4 antibody, atp2b4.L antibody, atp2b4 antibody, Atp2b4 antibody
- Background
- ATP2B4 belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis.
- Molecular Weight
- 129 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-