IGSF11 antibody (Middle Region)
-
- Target See all IGSF11 Antibodies
- IGSF11 (Immunoglobulin Superfamily, Member 11 (IGSF11))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IGSF11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IGSF11 antibody was raised against the middle region of IGSF11
- Purification
- Affinity purified
- Immunogen
- IGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL
- Top Product
- Discover our top product IGSF11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IGSF11 Blocking Peptide, catalog no. 33R-2510, is also available for use as a blocking control in assays to test for specificity of this IGSF11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGSF11 (Immunoglobulin Superfamily, Member 11 (IGSF11))
- Alternative Name
- IGSF11 (IGSF11 Products)
- Synonyms
- sc:d812 antibody, seurat antibody, BT-IgSF antibody, CT119 antibody, CXADRL1 antibody, Igsf13 antibody, VSIG3 antibody, 1700025L02Rik antibody, immunoglobulin superfamily member 11 antibody, immunoglobulin superfamily member 11 L homeolog antibody, immunoglobulin superfamily, member 11 antibody, IGSF11 antibody, igsf11 antibody, igsf11.L antibody, Igsf11 antibody
- Background
- IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth.IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor and endothelial cell-selective adhesion molecule.
- Molecular Weight
- 46 kDa (MW of target protein)
-