LY6G6F antibody (Middle Region)
-
- Target See all LY6G6F Antibodies
- LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LY6G6F antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C6 ORF21 antibody was raised against the middle region of C6 rf21
- Purification
- Affinity purified
- Immunogen
- C6 ORF21 antibody was raised using the middle region of C6 rf21 corresponding to a region with amino acids LLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPR
- Top Product
- Discover our top product LY6G6F Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C6ORF21 Blocking Peptide, catalog no. 33R-5121, is also available for use as a blocking control in assays to test for specificity of this C6ORF21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))
- Alternative Name
- C6ORF21 (LY6G6F Products)
- Synonyms
- C6orf21 antibody, G6f antibody, LY6G6D antibody, NG32 antibody, CJ068215 antibody, C6ORF21 antibody, lymphocyte antigen 6 family member G6F antibody, lymphocyte antigen 6 complex, locus G6F antibody, LY6G6F antibody, Ly6g6f antibody
- Background
- The human G6f protein(C6orf21) is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition.It may also play a role in the downstream signal transduction pathways involving GRB2 and GRB7.
- Molecular Weight
- 31 kDa (MW of target protein)
-