CUTA antibody

Catalog No. ABIN635010

Product Details anti-CUTA Antibody

Target: CUTA (Protein CutA (CUTA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CUTA antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CUTA antibody was raised using a synthetic peptide corresponding to a region with amino acids AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CUTA Blocking Peptide, catalog no. 33R-1183, is also available for use as a blocking control in assays to test for specificity of this CUTA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CUTA

Target: CUTA (Protein CutA (CUTA))

Alternative Name: CUTA (CUTA Products)

Synonyms: ACHAP antibody, C6orf82 antibody, 0610039D01Rik antibody, 1810022E02Rik antibody, 1810060C03Rik antibody, 2700094G22Rik antibody, AI326454 antibody, CutA1 antibody, cutA divalent cation tolerance homolog antibody, CUTA antibody, Cuta antibody

Background: CUTA may forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE).

Molecular Weight: 19 kDa (MW of target protein)