SLC32A1 antibody
-
- Target See all SLC32A1 Antibodies
- SLC32A1 (Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC32A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC32 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE
- Top Product
- Discover our top product SLC32A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC32A1 Blocking Peptide, catalog no. 33R-3196, is also available for use as a blocking control in assays to test for specificity of this SLC32A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC32A1 (Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1))
- Alternative Name
- SLC32A1 (SLC32A1 Products)
- Synonyms
- VGAT antibody, VIAAT antibody, vGAT antibody, Ci-vGAT antibody, slc32a1 antibody, viaat antibody, MGC68938 antibody, vgat antibody, xVIAAT antibody, R75019 antibody, Viaat antibody, CG8394 antibody, CG8394.2 antibody, Dmel\\CG8394 antibody, Vgat antibody, zgc:158324 antibody, solute carrier family 32 member 1 antibody, vesicular GABA transporter antibody, solute carrier family 32 member 1 S homeolog antibody, vesicular inhibitory amino acid transporter antibody, Vesicular inhibitory amino acid transporter antibody, solute carrier family 32 (GABA vesicular transporter), member 1 antibody, Vesicular GABA Transporter antibody, SLC32A1 antibody, vgat antibody, Bm1_20950 antibody, slc32a1.S antibody, slc32a1 antibody, CpipJ_CPIJ002704 antibody, viaat antibody, Slc32a1 antibody, VGAT antibody, Tsp_04599 antibody
- Background
- SLC32A1 is involved in the uptake of GABA and glycine into the synaptic vesicles.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Proton Transport
-