ERGIC3 antibody (C-Term)

Catalog No. ABIN635020

Product Details anti-ERGIC3 Antibody

Target: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERGIC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ERGIC3 antibody was raised against the C terminal of ERGIC3

Purification: Affinity purified

Immunogen: ERGIC3 antibody was raised using the C terminal of ERGIC3 corresponding to a region with amino acids LTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERGIC3 Blocking Peptide, catalog no. 33R-5472, is also available for use as a blocking control in assays to test for specificity of this ERGIC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERGIC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERGIC3

Target: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Alternative Name: ERGIC3 (ERGIC3 Products)

Synonyms: sdbcag84 antibody, zgc:113959 antibody, zgc:55762 antibody, C20orf47 antibody, CGI-54 antibody, Erv46 antibody, NY-BR-84 antibody, PRO0989 antibody, SDBCAG84 antibody, dJ477O4.2 antibody, 2310015B14Rik antibody, AV318804 antibody, D2Ucla1 antibody, Sdbcag84 antibody, ERGIC and golgi 3 antibody, ERGIC3 antibody, ergic3 antibody, Ergic3 antibody

Background: ERGIC3 plays a possible role in transport between endoplasmic reticulum and Golgi.

Molecular Weight: 43 kDa (MW of target protein)