COX10 antibody (Middle Region)

Catalog No. ABIN635052

Product Details anti-COX10 Antibody

Target: COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COX10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: COX10 antibody was raised against the middle region of COX10

Purification: Affinity purified

Immunogen: COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COX10 Blocking Peptide, catalog no. 33R-2170, is also available for use as a blocking control in assays to test for specificity of this COX10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COX10

Target: COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))

Alternative Name: COX10 (COX10 Products)

Synonyms: 2410004F01Rik antibody, AU042636 antibody, im:7145568 antibody, im:7157205 antibody, wu:fb18a03 antibody, F4I1.50 antibody, F4I1_50 antibody, cytochrome c oxidase 10 antibody, Cox10 antibody, cytochrome c oxidase assembly protein 10 antibody, COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor antibody, COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor L homeolog antibody, COX10, heme A:farnesyltransferase cytochrome c oxidase assembly factor antibody, cytochrome c oxidase 10 antibody, protoheme IX farnesyltransferase, mitochondrial antibody, Cox10 antibody, cox10 antibody, cox10.L antibody, COX10 antibody, LOC100732273 antibody

Background: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is a heme A farnesyltransferase.

Molecular Weight: 49 kDa (MW of target protein)