PEMT antibody (C-Term)

Catalog No. ABIN635064

Product Details anti-PEMT Antibody

Target: PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEMT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PEMT antibody was raised against the C terminal of PEMT

Purification: Affinity purified

Immunogen: PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEMT Blocking Peptide, catalog no. 33R-3664, is also available for use as a blocking control in assays to test for specificity of this PEMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEMT

Target: PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))

Alternative Name: PEMT (PEMT Products)

Synonyms: zgc:55479 antibody, DDBDRAFT_0204815 antibody, DDBDRAFT_0267053 antibody, DDB_0204815 antibody, DDB_0267053 antibody, DDBDRAFT_0219474 antibody, DDBDRAFT_0267052 antibody, DDB_0219474 antibody, DDB_0267052 antibody, PEAMT antibody, PEMPT antibody, PEMT2 antibody, PNMT antibody, AI255394 antibody, Pempt antibody, Pempt2 antibody, PHOMETH antibody, phosphatidylethanolamine N-methyltransferase antibody, pemt antibody, MCA3065 antibody, pmtA antibody, CNG04250 antibody, pemtA antibody, pemtB antibody, PEMT antibody, Pemt antibody

Background: PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17.

Molecular Weight: 26 kDa (MW of target protein)