PEMT antibody (C-Term)
-
- Target See all PEMT Antibodies
- PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PEMT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PEMT antibody was raised against the C terminal of PEMT
- Purification
- Affinity purified
- Immunogen
- PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS
- Top Product
- Discover our top product PEMT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PEMT Blocking Peptide, catalog no. 33R-3664, is also available for use as a blocking control in assays to test for specificity of this PEMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))
- Alternative Name
- PEMT (PEMT Products)
- Synonyms
- zgc:55479 antibody, DDBDRAFT_0204815 antibody, DDBDRAFT_0267053 antibody, DDB_0204815 antibody, DDB_0267053 antibody, DDBDRAFT_0219474 antibody, DDBDRAFT_0267052 antibody, DDB_0219474 antibody, DDB_0267052 antibody, PEAMT antibody, PEMPT antibody, PEMT2 antibody, PNMT antibody, AI255394 antibody, Pempt antibody, Pempt2 antibody, PHOMETH antibody, phosphatidylethanolamine N-methyltransferase antibody, pemt antibody, MCA3065 antibody, pmtA antibody, CNG04250 antibody, pemtA antibody, pemtB antibody, PEMT antibody, Pemt antibody
- Background
- PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17.
- Molecular Weight
- 26 kDa (MW of target protein)
-