SLC25A20 antibody
-
- Target See all SLC25A20 Antibodies
- SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A20 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC25 A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEW
- Top Product
- Discover our top product SLC25A20 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A20 Blocking Peptide, catalog no. 33R-8804, is also available for use as a blocking control in assays to test for specificity of this SLC25A20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))
- Alternative Name
- SLC25A20 (SLC25A20 Products)
- Synonyms
- 5848 antibody, BG:DS02740.15 antibody, CACT antibody, CG5848 antibody, Cact antibody, Dmel\\CG5848 antibody, cac antibody, dip6 antibody, fs(2)ltoRN48 antibody, n(2)k17003 antibody, cact antibody, dif-1 antibody, SLC25A20 antibody, DKFZp468F1219 antibody, zgc:77760 antibody, PRKAR2A antibody, CAC antibody, 1110007P09Rik antibody, C78826 antibody, mCAC antibody, cactus antibody, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 antibody, solute carrier family 25 member 20 antibody, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 L homeolog antibody, solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20 antibody, cact antibody, slc25a20 antibody, SLC25A20 antibody, Slc25a20 antibody, slc25a20.L antibody
- Background
- SLC25A20 is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- TCR Signaling, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location, Toll-Like Receptors Cascades
-