SLC25A46 antibody (C-Term)

Catalog No. ABIN635085

Product Details anti-SLC25A46 Antibody

Target: SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A46 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC25 A46 antibody was raised against the C terminal of SLC25 46

Purification: Affinity purified

Immunogen: SLC25 A46 antibody was raised using the C terminal of SLC25 46 corresponding to a region with amino acids LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A46 Blocking Peptide, catalog no. 33R-5100, is also available for use as a blocking control in assays to test for specificity of this SLC25A46 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A46

Target: SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))

Alternative Name: SLC25A46 (SLC25A46 Products)

Synonyms: SLC25A46 antibody, MGC152354 antibody, zgc:92767 antibody, slc25a46 antibody, 1200007B05Rik antibody, AI325987 antibody, RGD1305072 antibody, solute carrier family 25 member 46 antibody, solute carrier family 25, member 46 antibody, solute carrier family 25 member 46 L homeolog antibody, SLC25A46 antibody, slc25a46 antibody, slc25a46.L antibody, Slc25a46 antibody

Background: SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins.

Molecular Weight: 46 kDa (MW of target protein)