NNT antibody (N-Term)

Catalog No. ABIN635092

Product Details anti-NNT Antibody

Target: NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NNT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NNT antibody was raised against the N terminal of NNT

Purification: Affinity purified

Immunogen: NNT antibody was raised using the N terminal of NNT corresponding to a region with amino acids IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NNT Blocking Peptide, catalog no. 33R-4206, is also available for use as a blocking control in assays to test for specificity of this NNT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NNT

Target: NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))

Alternative Name: NNT (NNT Products)

Synonyms: Afu5g02780 antibody, GCCD4 antibody, 4930423F13Rik antibody, AI323702 antibody, BB168308 antibody, wu:fa20d10 antibody, wu:fc86a04 antibody, zgc:76979 antibody, Nicotinamide Nucleotide Transhydrogenase antibody, nicotinamide nucleotide transhydrogenase antibody, nicotinamide nucleotide transhydrogenase L homeolog antibody, nnt-1 antibody, AFUA_5G02780 antibody, nnt antibody, NNT antibody, Nnt antibody, nnt.L antibody

Background: NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification.

Molecular Weight: 114 kDa (MW of target protein)

Pathways: Proton Transport