SLC15A2 antibody
-
- Target See all SLC15A2 Antibodies
- SLC15A2 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 2 (SLC15A2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC15A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC15 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV
- Top Product
- Discover our top product SLC15A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC15A2 Blocking Peptide, catalog no. 33R-3445, is also available for use as a blocking control in assays to test for specificity of this SLC15A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC15A2 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 2 (SLC15A2))
- Alternative Name
- SLC15A2 (SLC15A2 Products)
- Synonyms
- PEPT2 antibody, pept2 antibody, MGC64416 antibody, wu:fc84g07 antibody, wu:fi22a10 antibody, zgc:152684 antibody, OPT-3 antibody, 8430408C16Rik antibody, C78862 antibody, Pept2 antibody, solute carrier family 15 member 2 antibody, solute carrier family 15 member 2 L homeolog antibody, solute carrier family 15 (oligopeptide transporter), member 2 antibody, solute carrier family 15 (H+/peptide transporter), member 2 antibody, SLC15A2 antibody, slc15a2.L antibody, slc15a2 antibody, Slc15a2 antibody
- Background
- SLC15A2 belongs to the PTR2/POT transporter family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo.
- Molecular Weight
- 82 kDa (MW of target protein)
-