RNF121 antibody (Middle Region)

Catalog No. ABIN635123

Product Details anti-RNF121 Antibody

Target: RNF121 (Ring Finger Protein 121 (RNF121))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF121 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF121 antibody was raised against the middle region of RNF121

Purification: Affinity purified

Immunogen: RNF121 antibody was raised using the middle region of RNF121 corresponding to a region with amino acids GMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF121 Blocking Peptide, catalog no. 33R-3438, is also available for use as a blocking control in assays to test for specificity of this RNF121 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF121 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF121

Target: RNF121 (Ring Finger Protein 121 (RNF121))

Alternative Name: RNF121 (RNF121 Products)

Synonyms: 4930544L10Rik antibody, im:6907121 antibody, si:ch73-373k7.1 antibody, ring finger protein 121 antibody, RING finger protein 121 antibody, RNF121 antibody, rnf-121 antibody, Rnf121 antibody, rnf121 antibody

Background: The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. Three of them are supported by at least two independent transcripts or ESTs, the full length natures of others are not clear.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling