SLCO1C1 antibody (N-Term)

Catalog No. ABIN635126

Product Details anti-SLCO1C1 Antibody

Target: SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLCO1C1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLCO1 C1 antibody was raised against the N terminal of SLCO1 1

Purification: Affinity purified

Immunogen: SLCO1 C1 antibody was raised using the N terminal of SLCO1 1 corresponding to a region with amino acids VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLCO1C1 Blocking Peptide, catalog no. 33R-9482, is also available for use as a blocking control in assays to test for specificity of this SLCO1C1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-SLCO1C1 antibody (ABIN635126)

Szczupak, Peña, Bracho, Mei, Bas, Fernandez-Valle, Liu, Telischi, Ivan, Dinh: "Fluorescent Detection of Vestibular Schwannoma Using Intravenous Sodium Fluorescein In Vivo." in: Otology & neurotology : official publication of the American Otological Society, American Neurotology Society [and] European Academy of Otology and Neurotology, Vol. 42, Issue 4, pp. e503-e511, (2021) (PubMed).

Target Details for SLCO1C1

Target: SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))

Alternative Name: SLCO1C1 (SLCO1C1 Products)

Synonyms: OATP-F antibody, OATP1 antibody, OATP14 antibody, OATP1C1 antibody, OATPF antibody, OATPRP5 antibody, SLC21A14 antibody, OATP-14 antibody, Oatp2 antibody, Oatpf antibody, Slc21a14 antibody, Bsat1 antibody, Oatp14 antibody, solute carrier organic anion transporter family member 1C1 antibody, solute carrier organic anion transporter family, member 1c1 antibody, SLCO1C1 antibody, Slco1c1 antibody

Background: SLCO1C1 is a member of the organic anion transporter family. SLCO1C1 is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyroid hormones thyroxine, tri-iodothyronine and reverse tri-iodothyronine. Polymorphisms in the gene encoding this protein may be associated with fatigue and depression in patients suffering from hyperthyroidism.

Molecular Weight: 79 kDa (MW of target protein)