CLN6 antibody (Middle Region)
-
- Target See all CLN6 Antibodies
- CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLN6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CLN6 antibody was raised against the middle region of CLN6
- Purification
- Affinity purified
- Immunogen
- CLN6 antibody was raised using the middle region of CLN6 corresponding to a region with amino acids LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL
- Top Product
- Discover our top product CLN6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLN6 Blocking Peptide, catalog no. 33R-5287, is also available for use as a blocking control in assays to test for specificity of this CLN6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLN6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))
- Alternative Name
- CLN6 (CLN6 Products)
- Synonyms
- 1810065L06Rik antibody, AW743417 antibody, D9Bwg1455e antibody, nclf antibody, CLN4A antibody, HsT18960 antibody, cln6 antibody, zgc:103565 antibody, ceroid-lipofuscinosis, neuronal 6 antibody, CLN6, transmembrane ER protein antibody, CLN6, transmembrane ER protein S homeolog antibody, ceroid-lipofuscinosis, neuronal 6, late infantile, variant antibody, CLN6, transmembrane ER protein a antibody, Cln6 antibody, CLN6 antibody, cln6.S antibody, cln6a antibody
- Background
- CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-