FAM19A4 antibody (Middle Region)
-
- Target See all FAM19A4 Antibodies
- FAM19A4 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A4 (FAM19A4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM19A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM19 A4 antibody was raised against the middle region of FAM19 4
- Purification
- Affinity purified
- Immunogen
- FAM19 A4 antibody was raised using the middle region of FAM19 4 corresponding to a region with amino acids SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVA
- Top Product
- Discover our top product FAM19A4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM19A4 Blocking Peptide, catalog no. 33R-8840, is also available for use as a blocking control in assays to test for specificity of this FAM19A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM19A4 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A4 (FAM19A4))
- Alternative Name
- FAM19A4 (FAM19A4 Products)
- Synonyms
- TAFA-4 antibody, TAFA4 antibody, C130034I18Rik antibody, Fam19a4 Tafa-4 antibody, Tafa-4 antibody, family with sequence similarity 19 member A4, C-C motif chemokine like antibody, family with sequence similarity 19, member A4 antibody, FAM19A4 antibody, Fam19a4 antibody
- Background
- This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene.
- Molecular Weight
- 16 kDa (MW of target protein)
-