Slc6a14 antibody
-
- Target See all Slc6a14 Antibodies
- Slc6a14 (Solute Carrier Family 6 (Amino Acid Transporter), Member 14 (Slc6a14))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Slc6a14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC6 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW
- Top Product
- Discover our top product Slc6a14 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC6A14 Blocking Peptide, catalog no. 33R-9518, is also available for use as a blocking control in assays to test for specificity of this SLC6A14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Slc6a14 (Solute Carrier Family 6 (Amino Acid Transporter), Member 14 (Slc6a14))
- Alternative Name
- SLC6A14 (Slc6a14 Products)
- Synonyms
- BMIQ11 antibody, 1110007A17Rik antibody, 9030613J17Rik antibody, ATB0plus antibody, CATB0plus antibody, solute carrier family 6 member 14 antibody, solute carrier family 6 (neurotransmitter transporter), member 14 antibody, SLC6A14 antibody, Slc6a14 antibody
- Background
- This gene encodes a member of the solute carrier family 6. Members of this family are sodium and chloride dependent neurotransmitter transporters. The encoded protein transports both neutral and cationic amino acids.
- Molecular Weight
- 72 kDa (MW of target protein)
-