CISD2 antibody (N-Term)

Catalog No. ABIN635156

Product Details anti-CISD2 Antibody

Target: CISD2 (CDGSH Iron Sulfur Domain 2 (CISD2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CISD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CISD2 antibody was raised against the N terminal of CISD2

Purification: Affinity purified

Immunogen: CISD2 antibody was raised using the N terminal of CISD2 corresponding to a region with amino acids VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CISD2 Blocking Peptide, catalog no. 33R-9652, is also available for use as a blocking control in assays to test for specificity of this CISD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CISD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CISD2

Target: CISD2 (CDGSH Iron Sulfur Domain 2 (CISD2))

Alternative Name: CISD2 (CISD2 Products)

Synonyms: ERIS antibody, Miner1 antibody, NAF-1 antibody, WFS2 antibody, ZCD2 antibody, 1500009M05Rik antibody, 1500026J14Rik antibody, 1500031D15Rik antibody, AI848398 antibody, B630006A20Rik antibody, Noxp70 antibody, Zcd2 antibody, RGD1566242 antibody, zgc:64148 antibody, eris antibody, miner1 antibody, wfs2 antibody, zcd2 antibody, cisd2 antibody, BcDNA:RE49709 antibody, Dmel\\CG1458 antibody, CDGSH iron sulfur domain 2 antibody, CDGSH iron sulfur domain 2 L homeolog antibody, CDGSH iron sulfur domain 2 S homeolog antibody, CISD2 antibody, Cisd2 antibody, cisd2 antibody, cisd2.L antibody, cisd2.S antibody

Background: CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).

Molecular Weight: 15 kDa (MW of target protein)

Pathways: Activation of Innate immune Response