Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) (Middle Region) antibody

Catalog No. ABIN635159

Product Details

Target: Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: SLCO3 A1 antibody was raised against the middle region of SLCO3 1

Purification: Affinity purified

Immunogen: SLCO3 A1 antibody was raised using the middle region of SLCO3 1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLCO3A1 Blocking Peptide, catalog no. 33R-5925, is also available for use as a blocking control in assays to test for specificity of this SLCO3A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)

Alternative Name: SLCO3A1 (SLCO3A1 Products)

Synonyms: si:ch211-196l7.1 antibody, wu:fa93e11 antibody, OATP-D antibody, OATP3A1 antibody, OATPD antibody, SLC21A11 antibody, 5830414C08Rik antibody, Anr1 antibody, MJAM antibody, R75096 antibody, Slc21a11 antibody, solute carrier organic anion transporter family, member 3A1 antibody, solute carrier organic anion transporter family member 3A1 antibody, solute carrier organic anion transporter family, member 3a1 antibody, slco3a1 antibody, SLCO3A1 antibody, Slco3a1 antibody

Background: SLCO3A1 mediates the Na+-independent transport of organic anions such as estrone-3-sulfate. It mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.

Molecular Weight: 76 kDa (MW of target protein)