SLC41A1 antibody (N-Term)

Catalog No. ABIN635173

Product Details anti-SLC41A1 Antibody

Target: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC41A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC41 A1 antibody was raised against the N terminal of SLC41 1

Purification: Affinity purified

Immunogen: SLC41 A1 antibody was raised using the N terminal of SLC41 1 corresponding to a region with amino acids TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC41A1 Blocking Peptide, catalog no. 33R-9280, is also available for use as a blocking control in assays to test for specificity of this SLC41A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC41A1

Target: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Alternative Name: SLC41A1 (SLC41A1 Products)

Synonyms: fd54c09 antibody, wu:fd54c09 antibody, MgtE antibody, AI573938 antibody, B230315F01Rik antibody, solute carrier family 41 (magnesium transporter), member 1 antibody, solute carrier family 41 member 1 antibody, solute carrier family 41, member 1 antibody, slc41a1 antibody, SLC41A1 antibody, Slc41a1 antibody

Background: SLC41A1 belongs to the SLC41A transporter family. It acts as a magnesium transporter that is responsive to magnesium balance.

Molecular Weight: 55 kDa (MW of target protein)