TCTN3 antibody (Middle Region)

Catalog No. ABIN635221

Product Details anti-TCTN3 Antibody

Target: TCTN3 (Tectonic Family Member 3 (TCTN3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCTN3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TCTN3 antibody was raised against the middle region of TCTN3

Purification: Affinity purified

Immunogen: TCTN3 antibody was raised using the middle region of TCTN3 corresponding to a region with amino acids LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCTN3 Blocking Peptide, catalog no. 33R-5493, is also available for use as a blocking control in assays to test for specificity of this TCTN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCTN3

Target: TCTN3 (Tectonic Family Member 3 (TCTN3))

Alternative Name: TCTN3 (TCTN3 Products)

Background: TCTN3 may be involved in apoptosis regulation.

Molecular Weight: 64 kDa (MW of target protein)