SLC7A4 antibody
-
- Target See all SLC7A4 Antibodies
- SLC7A4 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC7A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC7 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN
- Top Product
- Discover our top product SLC7A4 Primary Antibody
-
-
- Application Notes
-
WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC7A4 Blocking Peptide, catalog no. 33R-3182, is also available for use as a blocking control in assays to test for specificity of this SLC7A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A4 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4))
- Alternative Name
- SLC7A4 (SLC7A4 Products)
- Synonyms
- MGC83777 antibody, SLC7A4 antibody, MGC147458 antibody, si:busm1-266f07.3 antibody, si:dz266f07.3 antibody, AI853530 antibody, CAT-4 antibody, CAT4 antibody, HCAT3 antibody, VH antibody, solute carrier family 7 member 4 antibody, solute carrier family 7 member 4 L homeolog antibody, cationic amino acid transporter 4 antibody, solute carrier family 7, member 4 antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 4 antibody, SLC7A4 antibody, slc7a4.L antibody, slc7a4 antibody, LOC100056096 antibody, Slc7a4 antibody
- Background
- SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
- Molecular Weight
- 68 kDa (MW of target protein)
-