VNN3 antibody (N-Term)

Catalog No. ABIN635233

Product Details anti-VNN3 Antibody

Target: VNN3 (Vanin 3 (VNN3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VNN3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VNN3 antibody was raised against the N terminal of VNN3

Purification: Affinity purified

Immunogen: VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VNN3 Blocking Peptide, catalog no. 33R-9602, is also available for use as a blocking control in assays to test for specificity of this VNN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VNN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VNN3

Target: VNN3 (Vanin 3 (VNN3))

Alternative Name: VNN3 (VNN3 Products)

Synonyms: HSA238982 antibody, foap-4 antibody, gpi-80 antibody, hdlcq8 antibody, tiff66 antibody, vnn1.2 antibody, vnn3 antibody, RGD1560609 antibody, VNN3 antibody, vanin 3 antibody, vanin 2 antibody, vascular non-inflammatory molecule 3-like antibody, vascular non-inflammatory molecule 3 antibody, VNN3 antibody, Vnn3 antibody, vnn2 antibody, LOC708748 antibody, LOC100067649 antibody

Background: This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described, the two most common variants are represented as RefSeqs.

Molecular Weight: 28 kDa (MW of target protein)