MOGAT1 antibody (C-Term)

Catalog No. ABIN635250

Product Details anti-MOGAT1 Antibody

Target: MOGAT1 (Monoacylglycerol O-Acyltransferase 1 (MOGAT1))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MOGAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MOGAT1 antibody was raised against the C terminal of MOGAT1

Purification: Affinity purified

Immunogen: MOGAT1 antibody was raised using the C terminal of MOGAT1 corresponding to a region with amino acids PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MOGAT1 Blocking Peptide, catalog no. 33R-7161, is also available for use as a blocking control in assays to test for specificity of this MOGAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOGAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MOGAT1

Target: MOGAT1 (Monoacylglycerol O-Acyltransferase 1 (MOGAT1))

Alternative Name: MOGAT1 (MOGAT1 Products)

Synonyms: DGAT2L antibody, DGAT2L1 antibody, MGAT1 antibody, 0610030A14Rik antibody, 1110064N14Rik antibody, Dgat2l antibody, Dgat2l1 antibody, mDC2 antibody, mogat2-a antibody, dgat2l1 antibody, mogat1 antibody, monoacylglycerol O-acyltransferase 1 antibody, 2-acylglycerol O-acyltransferase 1 antibody, monoacylglycerol O-acyltransferase 2, gene 2 L homeolog antibody, monoacylglycerol O-acyltransferase 1 L homeolog antibody, MOGAT1 antibody, mogt1 antibody, Mogat1 antibody, Tsp_09229 antibody, mogat2.2.L antibody, mogat1.L antibody

Background: Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.

Molecular Weight: 39 kDa (MW of target protein)