OSBPL8 antibody (N-Term)

Catalog No. ABIN635298

Product Details anti-OSBPL8 Antibody

Target: OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OSBPL8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OSBPL8 antibody was raised against the N terminal of OSBPL8

Purification: Affinity purified

Immunogen: OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OSBPL8 Blocking Peptide, catalog no. 33R-8722, is also available for use as a blocking control in assays to test for specificity of this OSBPL8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OSBPL8

Target: OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))

Alternative Name: OSBPL8 (OSBPL8 Products)

Synonyms: RGD1561474 antibody, DKFZp469P0923 antibody, MST120 antibody, MSTP120 antibody, ORP8 antibody, OSBP10 antibody, AA536976 antibody, AA536995 antibody, C730029P18Rik antibody, D330025H14Rik antibody, ORP-8 antibody, oxysterol binding protein-like 8 antibody, oxysterol binding protein like 8 antibody, oxysterol binding protein like 8 L homeolog antibody, oxysterol-binding protein-related protein 8 antibody, Osbpl8 antibody, OSBPL8 antibody, osbpl8.L antibody, osbpl8 antibody, LOC100175952 antibody

Background: OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.

Molecular Weight: 97 kDa (MW of target protein)