FAM3C antibody (C-Term)

Catalog No. ABIN635303

Product Details anti-FAM3C Antibody

Target: FAM3C (Family with Sequence Similarity 3, Member C (FAM3C))

Binding Specificity: C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM3C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM3 C antibody was raised against the C terminal of FAM3

Purification: Affinity purified

Immunogen: FAM3 C antibody was raised using the C terminal of FAM3 corresponding to a region with amino acids DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM3C Blocking Peptide, catalog no. 33R-2091, is also available for use as a blocking control in assays to test for specificity of this FAM3C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM3C

Target: FAM3C (Family with Sequence Similarity 3, Member C (FAM3C))

Alternative Name: FAM3C (FAM3C Products)

Synonyms: ILEI antibody, D6Wsu176e antibody, Ilei antibody, wu:fb99h11 antibody, wu:fi35h03 antibody, zgc:55444 antibody, zgc:77090 antibody, family with sequence similarity 3 member C antibody, family with sequence similarity 3, member C antibody, family with sequence similarity 3 member C L homeolog antibody, fam3c antibody, FAM3C antibody, Fam3c antibody, fam3c.L antibody

Background: FAM3C is a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.

Molecular Weight: 22 kDa (MW of target protein)