FAR2 antibody (C-Term)

Catalog No. ABIN635311

Product Details anti-FAR2 Antibody

Target: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MLSTD1 antibody was raised against the C terminal Of Mlstd1

Purification: Affinity purified

Immunogen: MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MLSTD1 Blocking Peptide, catalog no. 33R-10019, is also available for use as a blocking control in assays to test for specificity of this MLSTD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAR2

Target: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Alternative Name: MLSTD1 (FAR2 Products)

Synonyms: MLSTD1 antibody, SDR10E2 antibody, A230046P18 antibody, AW048109 antibody, BC055759 antibody, Mlstd1 antibody, RGD1565966 antibody, FAR2 antibody, FATTY ACID REDUCTASE 2 antibody, MALE STERILITY 2 antibody, MALE STERILITY PROTEIN 2 antibody, MEC18.1 antibody, fatty acyl-CoA reductase 2 antibody, fatty acyl CoA reductase 2 antibody, Jojoba acyl CoA reductase-related male sterility protein antibody, FAR2 antibody, Far2 antibody, MS2 antibody

Background: MLSTD1 catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome