SLC35E2 antibody (Middle Region)

Catalog No. ABIN635327

Product Details anti-SLC35E2 Antibody

Target: SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35E2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC35 E2 antibody was raised against the middle region of SLC35 2

Purification: Affinity purified

Immunogen: SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35E2 Blocking Peptide, catalog no. 33R-1007, is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35E2

Target: SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))

Alternative Name: SLC35E2 (SLC35E2 Products)

Synonyms: Slc35e2 antibody, SLC35E2 antibody, A530082C11Rik antibody, AI957035 antibody, solute carrier family 35, member E2B antibody, solute carrier family 35 member E2B antibody, solute carrier family 35 member E3 antibody, solute carrier family 35 member E2 antibody, solute carrier family 35, member E2 antibody, Slc35e2b antibody, SLC35E2B antibody, SLC35E3 antibody, SLC35E2 antibody, Slc35e2 antibody

Background: SLC35E2 is a putative transporter.

Molecular Weight: 29 kDa (MW of target protein)