SLC7A7 antibody
-
- Target See all SLC7A7 (Slc7a7) Antibodies
- SLC7A7 (Slc7a7) (Solute Carrier Family 7 (Amino Acid Transporter Light Chain, Y+L System), Member 7 (Slc7a7))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC7A7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC7 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI
- Top Product
- Discover our top product Slc7a7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC7A7 Blocking Peptide, catalog no. 33R-9952, is also available for use as a blocking control in assays to test for specificity of this SLC7A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A7 (Slc7a7) (Solute Carrier Family 7 (Amino Acid Transporter Light Chain, Y+L System), Member 7 (Slc7a7))
- Alternative Name
- SLC7A7 (Slc7a7 Products)
- Synonyms
- LAT3 antibody, LPI antibody, MOP-2 antibody, Y+LAT1 antibody, y+LAT-1 antibody, y+LAT1 antibody, AI790233 antibody, my+lat1 antibody, solute carrier family 7 member 7 antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 antibody, SLC7A7 antibody, Slc7a7 antibody
- Background
- The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
- Molecular Weight
- 56 kDa (MW of target protein)
-