ATP1B4 antibody

Catalog No. ABIN635356

Product Details anti-ATP1B4 Antibody

Target: ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP1B4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ATP1 B4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP1B4 Blocking Peptide, catalog no. 33R-1078, is also available for use as a blocking control in assays to test for specificity of this ATP1B4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP1B4

Target: ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))

Alternative Name: ATP1B4 (ATP1B4 Products)

Synonyms: 1110020B02Rik antibody, Ac2-628 antibody, ATPase, (Na+)/K+ transporting, beta 4 polypeptide antibody, ATPase Na+/K+ transporting family member beta 4 antibody, ATPase, Na+/K+ transporting, beta 4 polypeptide L homeolog antibody, Atp1b4 antibody, ATP1B4 antibody, atp1b4.L antibody

Background: This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Proton Transport