SLC7A2 antibody
-
- Target See all SLC7A2 Antibodies
- SLC7A2 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 2 (SLC7A2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC7A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC7 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
- Top Product
- Discover our top product SLC7A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC7A2 Blocking Peptide, catalog no. 33R-9430, is also available for use as a blocking control in assays to test for specificity of this SLC7A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A2 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 2 (SLC7A2))
- Alternative Name
- SLC7A2 (SLC7A2 Products)
- Synonyms
- slc7a2 antibody, CAT2 antibody, CAT-2 antibody, MGC83504 antibody, zgc:103686 antibody, ATRC2 antibody, HCAT2 antibody, AI158848 antibody, Atrc2 antibody, Cat2 antibody, Tea antibody, Cat2a antibody, Cat2b antibody, RCAT2 antibody, cCAT-2 antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 2 L homeolog antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 antibody, solute carrier family 7 member 2 antibody, slc7a2.2.L antibody, slc7a2 antibody, SLC7A2 antibody, Slc7a2 antibody
- Background
- SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.
- Molecular Weight
- 72 kDa (MW of target protein)
-