SLC35F3 antibody (Middle Region)

Catalog No. ABIN635380

Product Details anti-SLC35F3 Antibody

Target: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35F3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC35 F3 antibody was raised against the middle region of SLC35 3

Purification: Affinity purified

Immunogen: SLC35 F3 antibody was raised using the middle region of SLC35 3 corresponding to a region with amino acids LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35F3 Blocking Peptide, catalog no. 33R-5111, is also available for use as a blocking control in assays to test for specificity of this SLC35F3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35F3

Target: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Alternative Name: SLC35F3 (SLC35F3 Products)

Synonyms: B230375D17Rik antibody, slc35f3 antibody, zgc:171853 antibody, solute carrier family 35 member F3 antibody, putative thiamine transporter SLC35F3 antibody, solute carrier family 35, member F3 antibody, solute carrier family 35, member F3a antibody, SLC35F3 antibody, LOC718789 antibody, Slc35f3 antibody, slc35f3a antibody

Background: SLC35F3 is a multi-pass membrane proteinPotential. It belongs to the SLC35F solute transporter family. SLC35F3 is a putative solute transporter.

Molecular Weight: 55 kDa (MW of target protein)